Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
£0.00

A special place for your crystal balls or your trinkets.

Crystal Orb Stands
Oak Orb Stand Dish
Oak Orb Stand Dish
£9.99
Orb Stand Dish
Orb Stand Dish
£7.99
Orb Stand Dish
Orb Stand Dish
£7.99
Rustic
Rustic
£7.99
Hexagonal Dish
Hexagonal Dish
£19.99
Black Walnut 4
Black Walnut 4
£11.99
Black Walnut 3
Black Walnut 3
£9.99
Black Walnut Gentle Curve
Black Walnut Gentle Curve
£11.99
Black Walnut 2
Black Walnut 2
£9.99
Black Walnut
Black Walnut
£9.99
Blood wood dish
Blood wood dish
£19.99
Trinket Pot
Trinket Pot
£11.99
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i